PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J02279.1.p
Common NameEUGRSUZ_J02279
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 277aa    MW: 31647.1 Da    PI: 5.5956
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J02279.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-141461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd +lv+ +   G ++W+t+++  g+ R++k+c++rw +yl
  Eucgr.J02279.1.p 14 RGPWTIEEDHKLVNFILNNGIHCWRTVPKLAGLLRCGKSCRLRWINYL 61
                      89******************************99************97 PP

2Myb_DNA-binding57.63e-1867110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++T+ E+ ++++++ +lG++ W++Ia++++ gRt++++k++w++
  Eucgr.J02279.1.p  67 RGAFTEMEENQIIQLHSRLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                       89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-21564IPR009057Homeodomain-like
PROSITE profilePS5129413.646961IPR017930Myb domain
SuperFamilySSF466897.11E-2911108IPR009057Homeodomain-like
SMARTSM007172.8E-71363IPR001005SANT/Myb domain
PfamPF002493.2E-121461IPR001005SANT/Myb domain
CDDcd001672.05E-51661No hitNo description
PROSITE profilePS5129426.86162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2665117IPR009057Homeodomain-like
SMARTSM007173.3E-1766114IPR001005SANT/Myb domain
PfamPF002491.3E-1667110IPR001005SANT/Myb domain
CDDcd001674.97E-1269110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGPWTIE EDHKLVNFIL NNGIHCWRTV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGAF TEMEENQIIQ LHSRLGNRWS KIASHFPGRT DNEIKNHWNT RIKKKLKQLG  120
LDPINHQPIT EEDHSKNGDE EGQTNSSKEE EGVLSKVKSM DTQEQQEQPH LKLDEATDFL  180
LNNYELLLCG SLDEGVQGLN QESNRSISQS SNSICREDSS QNQSNSNGES NCSSSSLQEH  240
HNGGGVQQWV DSVDSMLSWD GFDFLEQELF YFEDRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-28121162105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J02279.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033365.10.0PREDICTED: myb-related protein 315
SwissprotP813942e-82MYB15_ANTMA; Myb-related protein 315
TrEMBLA0A059AG380.0A0A059AG38_EUCGR; Uncharacterized protein
STRINGPOPTR_0001s36220.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-84myb domain protein 40